Lineage for d2a7tb_ (2a7t B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635215Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2635231Protein Scorpion toxin [57097] (17 species)
  7. 2635271Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (2 PDB entries)
  8. 2635275Domain d2a7tb_: 2a7t B: [126366]
    automated match to d1dq7a_

Details for d2a7tb_

PDB Entry: 2a7t (more details), 2.2 Å

PDB Description: Crystal Structure of a novel neurotoxin from Buthus tamalus at 2.2A resolution.
PDB Compounds: (B:) Neurotoxin

SCOPe Domain Sequences for d2a7tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7tb_ g.3.7.1 (B:) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin [TaxId: 34647]}
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr

SCOPe Domain Coordinates for d2a7tb_:

Click to download the PDB-style file with coordinates for d2a7tb_.
(The format of our PDB-style files is described here.)

Timeline for d2a7tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a7ta_