Lineage for d2a7tb1 (2a7t B:1-64)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747384Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 747385Family g.3.7.1: Long-chain scorpion toxins [57096] (4 proteins)
  6. 747399Protein Scorpion toxin [57097] (17 species)
  7. 747433Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (2 PDB entries)
  8. 747437Domain d2a7tb1: 2a7t B:1-64 [126366]
    automatically matched to d1dq7a_

Details for d2a7tb1

PDB Entry: 2a7t (more details), 2.2 Å

PDB Description: Crystal Structure of a novel neurotoxin from Buthus tamalus at 2.2A resolution.
PDB Compounds: (B:) Neurotoxin

SCOP Domain Sequences for d2a7tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7tb1 g.3.7.1 (B:1-64) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin [TaxId: 34647]}
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr

SCOP Domain Coordinates for d2a7tb1:

Click to download the PDB-style file with coordinates for d2a7tb1.
(The format of our PDB-style files is described here.)

Timeline for d2a7tb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a7ta1