SCOP 1.73: Domain d2a7ta1: 2a7t A:1-64

Lineage for d2a7ta1 (2a7t A:1-64)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (5 families)

5. Family g.3.7.1: Long-chain scorpion toxins [57096] (4 proteins)

6. Protein Scorpion toxin [57097] (17 species)

7. Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (2 PDB entries)

8. Domain d2a7ta1: 2a7t A:1-64 [126365]
   automatically matched to d1dq7a_

Details for d2a7ta1

PDB Entry: 2a7t, 2.2 Å

PDB Description: Crystal Structure of a novel neurotoxin from Buthus tamalus at 2.2A resolution.

PDB Compounds: (A:) Neurotoxin

SCOP Domain Sequences for d2a7ta1:

Sequence; same for both SEQRES and ATOM records:

>d2a7ta1 g.3.7.1 (A:1-64) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin [TaxId: 34647]}
gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs
gkcr

Timeline for d2a7ta1:

• d2a7ta1 is new in SCOP 1.73
  
• d2a7ta1 appears in SCOP 1.75
  
• d2a7ta1 appears in the current release, SCOPe 2.08, called d2a7ta_