![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
![]() | Protein Scorpion toxin [57097] (17 species) |
![]() | Species Indian red scorpion (Buthus tamulus), neurotoxin [TaxId:34647] [57109] (2 PDB entries) |
![]() | Domain d2a7ta_: 2a7t A: [126365] automated match to d1dq7a_ |
PDB Entry: 2a7t (more details), 2.2 Å
SCOPe Domain Sequences for d2a7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7ta_ g.3.7.1 (A:) Scorpion toxin {Indian red scorpion (Buthus tamulus), neurotoxin [TaxId: 34647]} gedgyiadgdnctyictfnnychalctdkkgdsgacdwwvpygvvcwcedlptpvpirgs gkcr
Timeline for d2a7ta_: