![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [142010] (1 PDB entry) Uniprot P96885 20-277! Uniprot P96885 278-548 |
![]() | Domain d2a7sb2: 2a7s B:278-548 [126356] automated match to d2a7sa2 |
PDB Entry: 2a7s (more details), 2.9 Å
SCOPe Domain Sequences for d2a7sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7sb2 c.14.1.4 (B:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} pryqaaaptgpieenltdedleldtlipdspnqpydmhevitrllddefleiqagyaqni vvgfgridgrpvgivanqpthfagcldinasekaarfvrtcdcfnipivmlvdvpgflpg tdqeyngiirrgakllyaygeatvpkitvitrkayggaycvmgskdmgcdvnlawptaqi avmgasgavgfvyrqqlaeaaangedidklrlrlqqeyedtlvnpyvaaergyvdavipp shtrgyigtalrllerkiaqlppkkhgnvpl
Timeline for d2a7sb2: