Lineage for d2a7sb1 (2a7s B:20-277)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835938Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1836040Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. 1836041Species Mycobacterium tuberculosis [TaxId:1773] [142010] (1 PDB entry)
    Uniprot P96885 20-277! Uniprot P96885 278-548
  8. 1836044Domain d2a7sb1: 2a7s B:20-277 [126355]
    automated match to d2a7sa1

Details for d2a7sb1

PDB Entry: 2a7s (more details), 2.9 Å

PDB Description: Crystal Structure of the Acyl-CoA Carboxylase, AccD5, from Mycobacterium tuberculosis
PDB Compounds: (B:) Probable propionyl-CoA carboxylase beta chain 5

SCOPe Domain Sequences for d2a7sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7sb1 c.14.1.4 (B:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]}
idihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldala
khrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqela
iktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvysp
altdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdaf
dyvrellsylppnnstda

SCOPe Domain Coordinates for d2a7sb1:

Click to download the PDB-style file with coordinates for d2a7sb1.
(The format of our PDB-style files is described here.)

Timeline for d2a7sb1: