SCOPe 2.08: Domain d2a7lb2: 2a7l B:1-117

Lineage for d2a7lb2 (2a7l B:1-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin-protein ligase W (E2 W) [143061] (1 species)
   forms segment-swapped dimer

7. Species Human (Homo sapiens) [TaxId:9606] [143062] (1 PDB entry)
   Uniprot Q96B02 1-117

8. Domain d2a7lb2: 2a7l B:1-117 [126351]
   Other proteins in same PDB: d2a7la2, d2a7lb3
   automated match to d2a7la1
   complexed with na

Details for d2a7lb2

PDB Entry: 2a7l, 1.82 Å

PDB Description: Structure of the human hypothetical ubiquitin-conjugating enzyme, LOC55284

PDB Compounds: (B:) Hypothetical ubiquitin-conjugating enzyme LOC55284

SCOPe Domain Sequences for d2a7lb2:

Sequence; same for both SEQRES and ATOM records:

>d2a7lb2 d.20.1.1 (B:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]}
masmqkrlqkellalqndpppgmtlneksvqnsitqwivdmegapgtlyegekfqllfkf
ssrypfdspqvmftgenipvhphvysnghiclsiltedwspalsvqsvclsiismls

Timeline for d2a7lb2:

• d2a7lb2 first appeared in SCOP 1.73, called d2a7lb1
  
• d2a7lb2 appears in SCOPe 2.07