Lineage for d2a7kf_ (2a7k F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461344Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2461393Protein Carbapenem biosynthes protein CarB [142004] (1 species)
  7. 2461394Species Pectobacterium carotovorum [TaxId:554] [142005] (1 PDB entry)
    Uniprot Q9XB60 1-230
  8. 2461400Domain d2a7kf_: 2a7k F: [126346]
    automated match to d2a7ka1

Details for d2a7kf_

PDB Entry: 2a7k (more details), 2.24 Å

PDB Description: carboxymethylproline synthase (CarB) from pectobacterium carotovora, apo enzyme
PDB Compounds: (F:) CarB

SCOPe Domain Sequences for d2a7kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7kf_ c.14.1.3 (F:) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}
mvfeensdevrvitldhpnkhnpfsrtletsvkdalaranaddsvravvvyggaersfsa
ggdfnevkqlsrsedieewidrvidlyqavlnvnkptiaavdgyaigmgfqfalmfdqrl
mastanfvmpelkhgigcsvgaailgfthgfstmqeiiyqcqsldaprcvdyrlvnqvve
ssalldaaitqahvmasypasafintkravnkpfihlleqtrdask

SCOPe Domain Coordinates for d2a7kf_:

Click to download the PDB-style file with coordinates for d2a7kf_.
(The format of our PDB-style files is described here.)

Timeline for d2a7kf_: