Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Elastase [50536] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries) |
Domain d2a7ja1: 2a7j A:1-240 [126340] automatically matched to d1c1ma_ complexed with act, ca, cl |
PDB Entry: 2a7j (more details), 1.65 Å
SCOP Domain Sequences for d2a7ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7ja1 b.47.1.2 (A:1-240) Elastase {Pig (Sus scrofa) [TaxId: 9823]} vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
Timeline for d2a7ja1: