SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2a7ja_ (2a7j A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056282Protein Elastase [50536] (4 species)
  7. 2056299Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)
  8. 2056323Domain d2a7ja_: 2a7j A: [126340]
    automated match to d1c1ma_
    complexed with act, ca, cl

Details for d2a7ja_

PDB Entry: 2a7j (more details), 1.65 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength
PDB Compounds: (A:) Elastase 1

SCOPe Domain Sequences for d2a7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7ja_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d2a7ja_:

Click to download the PDB-style file with coordinates for d2a7ja_.
(The format of our PDB-style files is described here.)

Timeline for d2a7ja_: