SCOPe 2.08: Domain d2a7ix_: 2a7i X:

Lineage for d2a7ix_ (2a7i X:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein automated matches [190195] (6 species)
   not a true protein

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)

8. Domain d2a7ix_: 2a7i X: [126339]
   automated match to d1rqwa_
   complexed with tla

Details for d2a7ix_

PDB Entry: 2a7i, 1.75 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength

PDB Compounds: (X:) thaumatin I

SCOPe Domain Sequences for d2a7ix_:

Sequence; same for both SEQRES and ATOM records:

>d2a7ix_ b.25.1.1 (X:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d2a7ix_:

• d2a7ix_ first appeared in SCOP 1.73, called d2a7ix1
  
• d2a7ix_ appears in SCOPe 2.07