SCOP 1.73: Domain d2a7ha1: 2a7h A:7-229

Lineage for d2a7ha1 (2a7h A:7-229)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (271 PDB entries)

8. Domain d2a7ha1: 2a7h A:7-229 [126338]
   automatically matched to d1tgsz_
   complexed with ca, cl

Details for d2a7ha1

PDB Entry: 2a7h, 2.1 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength

PDB Compounds: (A:) cationic trypsin

SCOP Domain Sequences for d2a7ha1:

Sequence; same for both SEQRES and ATOM records:

>d2a7ha1 b.47.1.2 (A:7-229) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2a7ha1:

• d2a7ha1 is new in SCOP 1.73
  
• d2a7ha1 appears in SCOP 1.75
  
• d2a7ha1 appears in the current release, SCOPe 2.08, called d2a7ha_