SCOP 1.75: Domain d2a7aa1: 2a7a A:1-237

Lineage for d2a7aa1 (2a7a A:1-237)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Concanavalin A [49901] (2 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (52 PDB entries)
   Uniprot P81461

8. Domain d2a7aa1: 2a7a A:1-237 [126332]
   automatically matched to d1apna_
   complexed with ca, mn, xe

Details for d2a7aa1

PDB Entry: 2a7a, 1.75 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength

PDB Compounds: (A:) concanavalin a

SCOP Domain Sequences for d2a7aa1:

Sequence; same for both SEQRES and ATOM records:

>d2a7aa1 b.29.1.1 (A:1-237) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d2a7aa1:

• d2a7aa1 first appeared in SCOP 1.73
  
• d2a7aa1 is called d2a7aa_ in SCOPe 2.01
  
• d2a7aa1 appears in the current release, SCOPe 2.08, called d2a7aa_