Lineage for d2a7aa1 (2a7a A:1-237)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663175Protein Concanavalin A [49901] (2 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 663181Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (50 PDB entries)
  8. 663189Domain d2a7aa1: 2a7a A:1-237 [126332]
    automatically matched to d1apna_
    complexed with ca, mn, xe

Details for d2a7aa1

PDB Entry: 2a7a (more details), 1.75 Å

PDB Description: On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength
PDB Compounds: (A:) concanavalin a

SCOP Domain Sequences for d2a7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7aa1 b.29.1.1 (A:1-237) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOP Domain Coordinates for d2a7aa1:

Click to download the PDB-style file with coordinates for d2a7aa1.
(The format of our PDB-style files is described here.)

Timeline for d2a7aa1: