SCOPe 2.05: Domain d2a78b_: 2a78 B:

Lineage for d2a78b_ (2a78 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Exoenzyme c3 [56414] (4 species)

7. Species Clostridium botulinum [TaxId:1491] [56415] (6 PDB entries)
   Uniprot P15879 41-251

8. Domain d2a78b_: 2a78 B: [126330]
   Other proteins in same PDB: d2a78a_
   automated match to d1g24a_
   complexed with gdp, mg

Details for d2a78b_

PDB Entry: 2a78, 1.81 Å

PDB Description: crystal structure of the c3bot-rala complex reveals a novel type of action of a bacterial exoenzyme

PDB Compounds: (B:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2a78b_:

Sequence; same for both SEQRES and ATOM records:

>d2a78b_ d.166.1.1 (B:) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmmgtainpk

Timeline for d2a78b_:

• d2a78b_ first appeared in SCOP 1.73, called d2a78b1
  
• d2a78b_ appears in SCOPe 2.04
  
• d2a78b_ appears in SCOPe 2.06
  
• d2a78b_ appears in the current release, SCOPe 2.08