![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein Exoenzyme c3 [56414] (4 species) |
![]() | Species Clostridium botulinum [TaxId:1491] [56415] (6 PDB entries) Uniprot P15879 41-251 |
![]() | Domain d2a78b_: 2a78 B: [126330] Other proteins in same PDB: d2a78a_ automated match to d1g24a_ complexed with gdp, mg |
PDB Entry: 2a78 (more details), 1.81 Å
SCOPe Domain Sequences for d2a78b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a78b_ d.166.1.1 (B:) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]} tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh iddmrlssdgkqiiitatmmgtainpk
Timeline for d2a78b_: