SCOP 1.73: Domain d2a78b1: 2a78 B:45-251

Lineage for d2a78b1 (2a78 B:45-251)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (7 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)

6. Protein Exoenzyme c3 [56414] (3 species)

7. Species Clostridium botulinum [TaxId:1491] [56415] (8 PDB entries)

8. Domain d2a78b1: 2a78 B:45-251 [126330]
   Other proteins in same PDB: d2a78a1
   automatically matched to d1g24a_
   complexed with gdp, mg

Details for d2a78b1

PDB Entry: 2a78, 1.81 Å

PDB Description: crystal structure of the c3bot-rala complex reveals a novel type of action of a bacterial exoenzyme

PDB Compounds: (B:) Mono-ADP-ribosyltransferase C3

SCOP Domain Sequences for d2a78b1:

Sequence; same for both SEQRES and ATOM records:

>d2a78b1 d.166.1.1 (B:45-251) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmmgtainpk

Timeline for d2a78b1:

• d2a78b1 is new in SCOP 1.73
  
• d2a78b1 appears in SCOP 1.75
  
• d2a78b1 appears in the current release, SCOPe 2.08, called d2a78b_