Lineage for d2a78a1 (2a78 A:13-182)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 696289Protein Ras-related protein RalA [89662] (2 species)
  7. 696297Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)
  8. 696298Domain d2a78a1: 2a78 A:13-182 [126329]
    Other proteins in same PDB: d2a78b1
    automatically matched to d1uada_
    complexed with gdp, mg

Details for d2a78a1

PDB Entry: 2a78 (more details), 1.81 Å

PDB Description: crystal structure of the c3bot-rala complex reveals a novel type of action of a bacterial exoenzyme
PDB Compounds: (A:) Ras-related protein Ral-A

SCOP Domain Sequences for d2a78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a78a1 c.37.1.8 (A:13-182) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle
dkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmed

SCOP Domain Coordinates for d2a78a1:

Click to download the PDB-style file with coordinates for d2a78a1.
(The format of our PDB-style files is described here.)

Timeline for d2a78a1: