Lineage for d2a75a2 (2a75 A:1-403)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807958Protein automated matches [193245] (21 species)
    not a true protein
  7. 2808097Species Trypanosoma rangeli [TaxId:5698] [255026] (3 PDB entries)
  8. 2808099Domain d2a75a2: 2a75 A:1-403 [126327]
    Other proteins in same PDB: d2a75a1, d2a75a3
    automated match to d1n1ta2
    complexed with fsi, so4

Details for d2a75a2

PDB Entry: 2a75 (more details), 1.95 Å

PDB Description: trypanosoma rangeli sialidase in complex with 2,3- difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2a75a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a75a2 b.68.1.1 (A:1-403) automated matches {Trypanosoma rangeli [TaxId: 5698]}
lapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryetsfd
nsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrns
wtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefiggv
gaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavlewegk
liinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkrv
mlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhein
tndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpa

SCOPe Domain Coordinates for d2a75a2:

Click to download the PDB-style file with coordinates for d2a75a2.
(The format of our PDB-style files is described here.)

Timeline for d2a75a2: