Lineage for d2a75a1 (2a75 A:404-631)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781413Species Trypanosoma rangeli [TaxId:5698] [255027] (3 PDB entries)
  8. 2781415Domain d2a75a1: 2a75 A:404-631 [126326]
    Other proteins in same PDB: d2a75a2, d2a75a3
    automated match to d1n1ta1
    complexed with fsi, so4

Details for d2a75a1

PDB Entry: 2a75 (more details), 1.95 Å

PDB Description: trypanosoma rangeli sialidase in complex with 2,3- difluorosialic acid (covalent intermediate)
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d2a75a1:

Sequence, based on SEQRES records: (download)

>d2a75a1 b.29.1.0 (A:404-631) automated matches {Trypanosoma rangeli [TaxId: 5698]}
tppskggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvggga
vwpvarqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknr
qwrplygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdis
hfyiggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

Sequence, based on observed residues (ATOM records): (download)

>d2a75a1 b.29.1.0 (A:404-631) automated matches {Trypanosoma rangeli [TaxId: 5698]}
tpkggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavw
pvarqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqw
rplygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishf
yiggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtd

SCOPe Domain Coordinates for d2a75a1:

Click to download the PDB-style file with coordinates for d2a75a1.
(The format of our PDB-style files is described here.)

Timeline for d2a75a1: