Lineage for d2a71d1 (2a71 D:12-227)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 795172Family b.29.1.13: Lectin leg-like [74904] (3 proteins)
    mammalian protein related to legume lectins
  6. 795188Protein Emp47p N-terminal domain [141146] (1 species)
  7. 795189Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries)
    Uniprot P43555 35-255! Uniprot P43555 36-259
  8. 795197Domain d2a71d1: 2a71 D:12-227 [126325]
    automatically matched to 2A6Z A:7-227

Details for d2a71d1

PDB Entry: 2a71 (more details), 2.7 Å

PDB Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), orthorhombic crystal form
PDB Compounds: (D:) Emp47p

SCOP Domain Sequences for d2a71d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a71d1 b.29.1.13 (D:12-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsftme
wtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlrgql
ndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqtrkv
rfpsgsyrigvtaqngavnnnaesfeifkmqffngv

SCOP Domain Coordinates for d2a71d1:

Click to download the PDB-style file with coordinates for d2a71d1.
(The format of our PDB-style files is described here.)

Timeline for d2a71d1: