Lineage for d2a71b_ (2a71 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390017Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2390029Protein Emp47p N-terminal domain [141146] (1 species)
  7. 2390030Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries)
    Uniprot P43555 35-255! Uniprot P43555 36-259
  8. 2390036Domain d2a71b_: 2a71 B: [126323]
    automated match to d2a6za1

Details for d2a71b_

PDB Entry: 2a71 (more details), 2.7 Å

PDB Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), orthorhombic crystal form
PDB Compounds: (B:) Emp47p

SCOPe Domain Sequences for d2a71b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a71b_ b.29.1.13 (B:) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsf
tmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlr
gqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqt
rkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv

SCOPe Domain Coordinates for d2a71b_:

Click to download the PDB-style file with coordinates for d2a71b_.
(The format of our PDB-style files is described here.)

Timeline for d2a71b_: