Lineage for d2a71b1 (2a71 B:9-227)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664202Family b.29.1.13: Lectin leg-like [74904] (3 proteins)
    mammalian protein related to legume lectins
  6. 664218Protein Emp47p N-terminal domain [141146] (1 species)
  7. 664219Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries)
  8. 664225Domain d2a71b1: 2a71 B:9-227 [126323]
    automatically matched to 2A6Z A:7-227

Details for d2a71b1

PDB Entry: 2a71 (more details), 2.7 Å

PDB Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), orthorhombic crystal form
PDB Compounds: (B:) Emp47p

SCOP Domain Sequences for d2a71b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a71b1 b.29.1.13 (B:9-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsf
tmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlr
gqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqt
rkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv

SCOP Domain Coordinates for d2a71b1:

Click to download the PDB-style file with coordinates for d2a71b1.
(The format of our PDB-style files is described here.)

Timeline for d2a71b1: