![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.13: Lectin leg-like [74904] (3 proteins) mammalian protein related to legume lectins |
![]() | Protein Emp47p N-terminal domain [141146] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries) |
![]() | Domain d2a71b1: 2a71 B:9-227 [126323] automatically matched to 2A6Z A:7-227 |
PDB Entry: 2a71 (more details), 2.7 Å
SCOP Domain Sequences for d2a71b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a71b1 b.29.1.13 (B:9-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} asklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkdsf tmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptlr gqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfqt rkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv
Timeline for d2a71b1: