SCOPe 2.08: Domain d2a70b2: 2a70 B:7-227

Lineage for d2a70b2 (2a70 B:7-227)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
   mammalian protein related to legume lectins
   automatically mapped to Pfam PF03388

6. Protein Emp47p N-terminal domain [141146] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries)
   Uniprot P43555 35-255! Uniprot P43555 36-259

8. Domain d2a70b2: 2a70 B:7-227 [126321]
   Other proteins in same PDB: d2a70a3, d2a70b3
   automated match to d2a6za1
   complexed with edo

Details for d2a70b2

PDB Entry: 2a70, 1.1 Å

PDB Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), monoclinic crystal form 2

PDB Compounds: (B:) Emp47p

SCOPe Domain Sequences for d2a70b2:

Sequence; same for both SEQRES and ATOM records:

>d2a70b2 b.29.1.13 (B:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkd
sftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgpt
lrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcf
qtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv

Timeline for d2a70b2:

• d2a70b2 first appeared in SCOP 1.73, called d2a70b1
  
• d2a70b2 appears in SCOPe 2.07