SCOP 1.73: Domain d2a70a1: 2a70 A:7-227

Lineage for d2a70a1 (2a70 A:7-227)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.13: Lectin leg-like [74904] (3 proteins)
   mammalian protein related to legume lectins

6. Protein Emp47p N-terminal domain [141146] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries)

8. Domain d2a70a1: 2a70 A:7-227 [126320]
   automatically matched to 2A6Z A:7-227
   complexed with edo

Details for d2a70a1

PDB Entry: 2a70, 1.1 Å

PDB Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), monoclinic crystal form 2

PDB Compounds: (A:) Emp47p

SCOP Domain Sequences for d2a70a1:

Sequence; same for both SEQRES and ATOM records:

>d2a70a1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkd
sftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgpt
lrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcf
qtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv

Timeline for d2a70a1:

• d2a70a1 is new in SCOP 1.73
  
• d2a70a1 appears in SCOP 1.75
  
• d2a70a1 appears in the current release, SCOPe 2.08, called d2a70a2