Lineage for d2a6za1 (2a6z A:7-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780347Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2780359Protein Emp47p N-terminal domain [141146] (1 species)
  7. 2780360Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries)
    Uniprot P43555 35-255! Uniprot P43555 36-259
  8. 2780361Domain d2a6za1: 2a6z A:7-227 [126319]
    Other proteins in same PDB: d2a6za2

Details for d2a6za1

PDB Entry: 2a6z (more details), 1 Å

PDB Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), monoclinic crystal form 1
PDB Compounds: (A:) Emp47p (form2)

SCOPe Domain Sequences for d2a6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkd
sftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgpt
lrgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcf
qtrkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngv

SCOPe Domain Coordinates for d2a6za1:

Click to download the PDB-style file with coordinates for d2a6za1.
(The format of our PDB-style files is described here.)

Timeline for d2a6za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a6za2