Lineage for d2a6ya1 (2a6y A:8-231)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781584Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 1781596Protein Emp47p N-terminal domain [141146] (1 species)
  7. 1781597Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries)
    Uniprot P43555 35-255! Uniprot P43555 36-259
  8. 1781601Domain d2a6ya1: 2a6y A:8-231 [126318]
    complexed with so4

Details for d2a6ya1

PDB Entry: 2a6y (more details), 1.42 Å

PDB Description: Crystal structure of Emp47p carbohydrate recognition domain (CRD), tetragonal crystal form
PDB Compounds: (A:) Emp47p (form1)

SCOPe Domain Sequences for d2a6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ya1 b.29.1.13 (A:8-231) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkds
ftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptl
rgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfq
trkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngvieds

SCOPe Domain Coordinates for d2a6ya1:

Click to download the PDB-style file with coordinates for d2a6ya1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ya1: