Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
Protein Emp47p N-terminal domain [141146] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141147] (4 PDB entries) Uniprot P43555 35-255! Uniprot P43555 36-259 |
Domain d2a6ya1: 2a6y A:8-231 [126318] complexed with so4 |
PDB Entry: 2a6y (more details), 1.42 Å
SCOPe Domain Sequences for d2a6ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ya1 b.29.1.13 (A:8-231) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dasklssdyslpdlintrkvpnnwqtgeqasleegrivltsnqnskgslwlkqgfdlkds ftmewtfrsvgysgqtdggisfwfvqdsniprdkqlyngpvnydglqllvdnngplgptl rgqlndgqkpvdktkiydqsfasclmgyqdssvpstirvtydleddnllkvqvdnkvcfq trkvrfpsgsyrigvtaqngavnnnaesfeifkmqffngvieds
Timeline for d2a6ya1: