| Class b: All beta proteins [48724] (165 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
| Family b.29.1.13: Lectin leg-like [74904] (3 proteins) mammalian protein related to legume lectins |
| Protein Emp46p N-terminal domain [141148] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141149] (3 PDB entries) |
| Domain d2a6xb1: 2a6x B:8-225 [126317] automatically matched to 2A6X A:8-225 complexed with edo, k; mutant |
PDB Entry: 2a6x (more details), 1.55 Å
SCOP Domain Sequences for d2a6xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6xb1 b.29.1.13 (B:8-225) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd
amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges
vtaflndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt
rkvkfmgsspfrigtsaindaskesfeilkmklydgvi
Timeline for d2a6xb1: