SCOP 1.73: Domain d2a6xb1: 2a6x B:8-225

Lineage for d2a6xb1 (2a6x B:8-225)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.13: Lectin leg-like [74904] (3 proteins)
   mammalian protein related to legume lectins

6. Protein Emp46p N-terminal domain [141148] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141149] (3 PDB entries)

8. Domain d2a6xb1: 2a6x B:8-225 [126317]
   automatically matched to 2A6X A:8-225
   complexed with edo, k; mutant

Details for d2a6xb1

PDB Entry: 2a6x, 1.55 Å

PDB Description: crystal structure of emp46p carbohydrate recognition domain (crd), y131f mutant

PDB Compounds: (B:) Emp46p

SCOP Domain Sequences for d2a6xb1:

Sequence; same for both SEQRES and ATOM records:

>d2a6xb1 b.29.1.13 (B:8-225) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd
amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges
vtaflndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt
rkvkfmgsspfrigtsaindaskesfeilkmklydgvi

Timeline for d2a6xb1:

• d2a6xb1 is new in SCOP 1.73
  
• d2a6xb1 appears in SCOP 1.75
  
• d2a6xb1 appears in the current release, SCOPe 2.08, called d2a6xb_