Lineage for d2a6xb_ (2a6x B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780347Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2780369Protein automated matches [190462] (2 species)
    not a true protein
  7. 2780370Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187378] (3 PDB entries)
  8. 2780372Domain d2a6xb_: 2a6x B: [126317]
    Other proteins in same PDB: d2a6xa1
    automated match to d2a6va1
    complexed with edo, k; mutant

Details for d2a6xb_

PDB Entry: 2a6x (more details), 1.55 Å

PDB Description: crystal structure of emp46p carbohydrate recognition domain (crd), y131f mutant
PDB Compounds: (B:) Emp46p

SCOPe Domain Sequences for d2a6xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6xb_ b.29.1.13 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd
amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges
vtaflndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt
rkvkfmgsspfrigtsaindaskesfeilkmklydgvie

SCOPe Domain Coordinates for d2a6xb_:

Click to download the PDB-style file with coordinates for d2a6xb_.
(The format of our PDB-style files is described here.)

Timeline for d2a6xb_: