Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
Protein automated matches [190462] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187378] (3 PDB entries) |
Domain d2a6xb_: 2a6x B: [126317] Other proteins in same PDB: d2a6xa1 automated match to d2a6va1 complexed with edo, k; mutant |
PDB Entry: 2a6x (more details), 1.55 Å
SCOPe Domain Sequences for d2a6xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6xb_ b.29.1.13 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges vtaflndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt rkvkfmgsspfrigtsaindaskesfeilkmklydgvie
Timeline for d2a6xb_: