Lineage for d2a6xa1 (2a6x A:8-225)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781584Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 1781592Protein Emp46p N-terminal domain [141148] (1 species)
  7. 1781593Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141149] (2 PDB entries)
    Uniprot Q12396 54-271! Uniprot Q12396 55-272
  8. 1781595Domain d2a6xa1: 2a6x A:8-225 [126316]
    Other proteins in same PDB: d2a6xb_
    complexed with edo, k; mutant

Details for d2a6xa1

PDB Entry: 2a6x (more details), 1.55 Å

PDB Description: crystal structure of emp46p carbohydrate recognition domain (crd), y131f mutant
PDB Compounds: (A:) Emp46p

SCOPe Domain Sequences for d2a6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6xa1 b.29.1.13 (A:8-225) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd
amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges
vtaflndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt
rkvkfmgsspfrigtsaindaskesfeilkmklydgvi

SCOPe Domain Coordinates for d2a6xa1:

Click to download the PDB-style file with coordinates for d2a6xa1.
(The format of our PDB-style files is described here.)

Timeline for d2a6xa1: