Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
Protein Emp46p N-terminal domain [141148] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141149] (2 PDB entries) Uniprot Q12396 54-271! Uniprot Q12396 55-272 |
Domain d2a6xa1: 2a6x A:8-225 [126316] Other proteins in same PDB: d2a6xb_ complexed with edo, k; mutant |
PDB Entry: 2a6x (more details), 1.55 Å
SCOPe Domain Sequences for d2a6xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6xa1 b.29.1.13 (A:8-225) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges vtaflndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt rkvkfmgsspfrigtsaindaskesfeilkmklydgvi
Timeline for d2a6xa1: