![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.13: Lectin leg-like [74904] (4 proteins) mammalian protein related to legume lectins automatically mapped to Pfam PF03388 |
![]() | Protein automated matches [190462] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187378] (3 PDB entries) |
![]() | Domain d2a6wb_: 2a6w B: [126315] automated match to d2a6va1 |
PDB Entry: 2a6w (more details), 1.75 Å
SCOPe Domain Sequences for d2a6wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6wb_ b.29.1.13 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lkwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikd amtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklges vtaylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqt rkvkfmgsspfrigtsaindaskesfeilkmklydgvie
Timeline for d2a6wb_: