Lineage for d2a6vb_ (2a6v B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051546Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2051568Protein automated matches [190462] (2 species)
    not a true protein
  7. 2051569Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187378] (3 PDB entries)
  8. 2051570Domain d2a6vb_: 2a6v B: [126313]
    Other proteins in same PDB: d2a6va1
    automated match to d2a6va1
    complexed with edo, k

Details for d2a6vb_

PDB Entry: 2a6v (more details), 1.52 Å

PDB Description: Crystal structure of Emp46p carbohydrate recognition domain (CRD), potassium-bound form
PDB Compounds: (B:) Emp46p

SCOPe Domain Sequences for d2a6vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6vb_ b.29.1.13 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kwnkgyslpnllevtdqqkelsqwtlgdkvkleegrfvltpgkntkgslwlkpeysikda
mtiewtfrsfgfrgstkgglafwlkqgnegdstelfggsskkfnglmillrlddklgesv
taylndgtkdldiesspyfasclfqyqdsmvpstlrltynpldnhllklqmdnrvcfqtr
kvkfmgsspfrigtsaindaskesfeilkmklydgvi

SCOPe Domain Coordinates for d2a6vb_:

Click to download the PDB-style file with coordinates for d2a6vb_.
(The format of our PDB-style files is described here.)

Timeline for d2a6vb_: