Lineage for d2a6ta1 (2a6t A:1-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015927Fold a.242: Dcp2 domain-like [140585] (1 superfamily)
    4 helices; orthogonal array of two alpha hairpins
  4. 2015928Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) (S)
    automatically mapped to Pfam PF05026
  5. 2015929Family a.242.1.1: Dcp2 box A domain [140587] (1 protein)
    Pfam PF05026
  6. 2015930Protein mRNA decapping enzyme Dcp2p, N-terminal domain [140588] (1 species)
  7. 2015931Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [140589] (3 PDB entries)
    Uniprot O13828 1-94
  8. 2015933Domain d2a6ta1: 2a6t A:1-94 [126309]
    Other proteins in same PDB: d2a6ta2, d2a6tb1

Details for d2a6ta1

PDB Entry: 2a6t (more details), 2.5 Å

PDB Description: Crystal structure of S.pombe mRNA decapping enzyme Dcp2p
PDB Compounds: (A:) spac19a8.12

SCOPe Domain Sequences for d2a6ta1:

Sequence, based on SEQRES records: (download)

>d2a6ta1 a.242.1.1 (A:1-94) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwskvheeafddflrykt

Sequence, based on observed residues (ATOM records): (download)

>d2a6ta1 a.242.1.1 (A:1-94) mRNA decapping enzyme Dcp2p, N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg
lrvfsaklfahcpllwkwheeafddflrykt

SCOPe Domain Coordinates for d2a6ta1:

Click to download the PDB-style file with coordinates for d2a6ta1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a6ta2
View in 3D
Domains from other chains:
(mouse over for more information)
d2a6tb1