![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
![]() | Superfamily d.298.1: RelE-like [143011] (3 families) ![]() Toxin component of plasmid stabilisation system |
![]() | Family d.298.1.1: YoeB/Txe-like [143012] (2 proteins) Pfam PF06769 |
![]() | Protein Toxin YoeB [143013] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143014] (3 PDB entries) Uniprot P69348 1-84 |
![]() | Domain d2a6rf_: 2a6r F: [126304] automated match to d2a6qe1 complexed with mg |
PDB Entry: 2a6r (more details), 2.05 Å
SCOPe Domain Sequences for d2a6rf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6rf_ d.298.1.1 (F:) Toxin YoeB {Escherichia coli [TaxId: 562]} mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri teehrlvyavtddslliaacryhy
Timeline for d2a6rf_: