SCOP 1.75: Domain d2a6re1: 2a6r E:1-84

Lineage for d2a6re1 (2a6r E:1-84)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (2 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.1: YoeB/Txe-like [143012] (1 protein)
   Pfam PF06769

6. Protein Toxin YoeB [143013] (1 species)

7. Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)
   Uniprot P69348 1-84

8. Domain d2a6re1: 2a6r E:1-84 [126303]
   automatically matched to 2A6Q E:1-84
   complexed with mg

Details for d2a6re1

PDB Entry: 2a6r, 2.05 Å

PDB Description: crystal structure of yoeb under peg condition

PDB Compounds: (E:) Toxin yoeB

SCOP Domain Sequences for d2a6re1:

Sequence; same for both SEQRES and ATOM records:

>d2a6re1 d.298.1.1 (E:1-84) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryhy

Timeline for d2a6re1:

• d2a6re1 first appeared in SCOP 1.73
  
• d2a6re1 is called d2a6re_ in SCOPe 2.01
  
• d2a6re1 appears in the current release, SCOPe 2.08, called d2a6re_