Lineage for d2a6rd1 (2a6r D:1-84)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741546Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 741547Superfamily d.298.1: RelE-like [143011] (2 families) (S)
    Toxin component of plasmid stabilisation system
  5. 741548Family d.298.1.1: YoeB/Txe-like [143012] (1 protein)
    Pfam PF06769
  6. 741549Protein Toxin YoeB [143013] (1 species)
  7. 741550Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)
  8. 741558Domain d2a6rd1: 2a6r D:1-84 [126302]
    automatically matched to 2A6Q E:1-84
    complexed with mg

Details for d2a6rd1

PDB Entry: 2a6r (more details), 2.05 Å

PDB Description: crystal structure of yoeb under peg condition
PDB Compounds: (D:) Toxin yoeB

SCOP Domain Sequences for d2a6rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6rd1 d.298.1.1 (D:1-84) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryhy

SCOP Domain Coordinates for d2a6rd1:

Click to download the PDB-style file with coordinates for d2a6rd1.
(The format of our PDB-style files is described here.)

Timeline for d2a6rd1: