![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
![]() | Superfamily d.298.1: RelE-like [143011] (2 families) ![]() Toxin component of plasmid stabilisation system |
![]() | Family d.298.1.1: YoeB/Txe-like [143012] (1 protein) Pfam PF06769 |
![]() | Protein Toxin YoeB [143013] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143014] (3 PDB entries) |
![]() | Domain d2a6rb1: 2a6r B:1-84 [126300] automatically matched to 2A6Q E:1-84 complexed with mg |
PDB Entry: 2a6r (more details), 2.05 Å
SCOP Domain Sequences for d2a6rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6rb1 d.298.1.1 (B:1-84) Toxin YoeB {Escherichia coli [TaxId: 562]} mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri teehrlvyavtddslliaacryhy
Timeline for d2a6rb1: