Lineage for d2a6qf1 (2a6q F:1-84)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882177Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 882178Superfamily d.298.1: RelE-like [143011] (2 families) (S)
    Toxin component of plasmid stabilisation system
  5. 882179Family d.298.1.1: YoeB/Txe-like [143012] (1 protein)
    Pfam PF06769
  6. 882180Protein Toxin YoeB [143013] (1 species)
  7. 882181Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)
    Uniprot P69348 1-84
  8. 882193Domain d2a6qf1: 2a6q F:1-84 [126298]
    Other proteins in same PDB: d2a6qa1, d2a6qb1, d2a6qc1, d2a6qd1
    automatically matched to 2A6Q E:1-84

Details for d2a6qf1

PDB Entry: 2a6q (more details), 2.05 Å

PDB Description: crystal structure of yefm-yoeb complex
PDB Compounds: (F:) Toxin yoeB

SCOP Domain Sequences for d2a6qf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6qf1 d.298.1.1 (F:1-84) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryhy

SCOP Domain Coordinates for d2a6qf1:

Click to download the PDB-style file with coordinates for d2a6qf1.
(The format of our PDB-style files is described here.)

Timeline for d2a6qf1: