Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) Toxin component of plasmid stabilisation system |
Family d.298.1.1: YoeB/Txe-like [143012] (2 proteins) Pfam PF06769 |
Protein Toxin YoeB [143013] (1 species) |
Species Escherichia coli [TaxId:562] [143014] (3 PDB entries) Uniprot P69348 1-84 |
Domain d2a6qf_: 2a6q F: [126298] Other proteins in same PDB: d2a6qa1, d2a6qa2, d2a6qb1, d2a6qb2, d2a6qc2, d2a6qc3, d2a6qd2, d2a6qd3 automated match to d2a6qe1 |
PDB Entry: 2a6q (more details), 2.05 Å
SCOPe Domain Sequences for d2a6qf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6qf_ d.298.1.1 (F:) Toxin YoeB {Escherichia coli [TaxId: 562]} mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri teehrlvyavtddslliaacryhy
Timeline for d2a6qf_: