SCOPe 2.08: Domain d2a6qd2: 2a6q D:10-64

Lineage for d2a6qd2 (2a6q D:10-64)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.306: YefM-like [143119] (1 superfamily)
   core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;

4. Superfamily d.306.1: YefM-like [143120] (2 families)

5. Family d.306.1.1: YefM-like [143121] (2 proteins)
   antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state
   automatically mapped to Pfam PF02604

6. Protein Antitoxin YefM [143122] (1 species)

7. Species Escherichia coli [TaxId:562] [143123] (1 PDB entry)
   Uniprot P69346 1-55! Uniprot P69346 1-83

8. Domain d2a6qd2: 2a6q D:10-64 [126296]
   Other proteins in same PDB: d2a6qa2, d2a6qb2, d2a6qc3, d2a6qd3, d2a6qe1, d2a6qf_
   automated match to d2a6qa1

Details for d2a6qd2

PDB Entry: 2a6q, 2.05 Å

PDB Description: crystal structure of yefm-yoeb complex

PDB Compounds: (D:) Antitoxin yefM

SCOPe Domain Sequences for d2a6qd2:

Sequence; same for both SEQRES and ATOM records:

>d2a6qd2 d.306.1.1 (D:10-64) Antitoxin YefM {Escherichia coli [TaxId: 562]}
mrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayll

Timeline for d2a6qd2:

• d2a6qd2 first appeared in SCOP 1.73, called d2a6qd1
  
• d2a6qd2 appears in SCOPe 2.07