Lineage for d2a6ob_ (2a6o B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2522840Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
    automatically mapped to Pfam PF01797
  5. 2522841Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 2522842Protein ISHP608 transposase [143426] (1 species)
  7. 2522843Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
    Uniprot Q933Z0 4-133
  8. 2522855Domain d2a6ob_: 2a6o B: [126292]
    automated match to d2a6mb_
    protein/DNA complex; protein/RNA complex

Details for d2a6ob_

PDB Entry: 2a6o (more details), 2.6 Å

PDB Description: crystal structure of the ishp608 transposase in complex with stem-loop dna
PDB Compounds: (B:) ISHp608 transposase

SCOPe Domain Sequences for d2a6ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ob_ d.58.57.1 (B:) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
vkqyienqqnsnrpkqkekwksyvdnlqtkal

SCOPe Domain Coordinates for d2a6ob_:

Click to download the PDB-style file with coordinates for d2a6ob_.
(The format of our PDB-style files is described here.)

Timeline for d2a6ob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a6oa_