SCOPe 2.08: Domain d2a6ob_: 2a6o B:

Lineage for d2a6ob_ (2a6o B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
   automatically mapped to Pfam PF01797

5. Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
   Pfam PF01797

6. Protein ISHP608 transposase [143426] (1 species)

7. Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
   Uniprot Q933Z0 4-133

8. Domain d2a6ob_: 2a6o B: [126292]
   automated match to d2a6mb_
   protein/DNA complex; protein/RNA complex

Details for d2a6ob_

PDB Entry: 2a6o, 2.6 Å

PDB Description: crystal structure of the ishp608 transposase in complex with stem-loop dna

PDB Compounds: (B:) ISHp608 transposase

SCOPe Domain Sequences for d2a6ob_:

Sequence; same for both SEQRES and ATOM records:

>d2a6ob_ d.58.57.1 (B:) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
vkqyienqqnsnrpkqkekwksyvdnlqtkal

Timeline for d2a6ob_:

• d2a6ob_ first appeared in SCOP 1.73, called d2a6ob1
  
• d2a6ob_ appears in SCOPe 2.07