SCOP 1.73: Domain d2a6oa1: 2a6o A:4-133

Lineage for d2a6oa1 (2a6o A:4-133)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer

5. Family d.58.57.1: Transposase IS200-like [143423] (3 proteins)
   Pfam PF01797

6. Protein ISHP608 transposase [143426] (1 species)

7. Species Helicobacter pylori [TaxId:210] [143427] (2 PDB entries)

8. Domain d2a6oa1: 2a6o A:4-133 [126291]
   automatically matched to 2A6M A:4-133

Details for d2a6oa1

PDB Entry: 2a6o, 2.6 Å

PDB Description: crystal structure of the ishp608 transposase in complex with stem-loop dna

PDB Compounds: (A:) ISHp608 transposase

SCOP Domain Sequences for d2a6oa1:

Sequence; same for both SEQRES and ATOM records:

>d2a6oa1 d.58.57.1 (A:4-133) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
vkqyienqqn

Timeline for d2a6oa1:

• d2a6oa1 is new in SCOP 1.73
  
• d2a6oa1 appears in SCOP 1.75
  
• d2a6oa1 appears in the current release, SCOPe 2.08, called d2a6oa_