Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Dihydrodipicolinate synthase [51574] (4 species) |
Species Escherichia coli [TaxId:562] [51575] (9 PDB entries) |
Domain d2a6nb1: 2a6n B:1-292 [126290] automatically matched to 2A6N A:1-292 complexed with k; mutant |
PDB Entry: 2a6n (more details), 1.94 Å
SCOP Domain Sequences for d2a6nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6nb1 c.1.10.1 (B:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk aiaehtdlpqilynvpsatgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll
Timeline for d2a6nb1: