Lineage for d2a6nb1 (2a6n B:1-292)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684065Protein Dihydrodipicolinate synthase [51574] (4 species)
  7. 684075Species Escherichia coli [TaxId:562] [51575] (9 PDB entries)
  8. 684081Domain d2a6nb1: 2a6n B:1-292 [126290]
    automatically matched to 2A6N A:1-292
    complexed with k; mutant

Details for d2a6nb1

PDB Entry: 2a6n (more details), 1.94 Å

PDB Description: dihydrodipicolinate synthase (e. coli)- mutant r138a
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOP Domain Sequences for d2a6nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6nb1 c.1.10.1 (B:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsatgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOP Domain Coordinates for d2a6nb1:

Click to download the PDB-style file with coordinates for d2a6nb1.
(The format of our PDB-style files is described here.)

Timeline for d2a6nb1: