SCOPe 2.01: Domain d2a6ma1: 2a6m A:4-133

Lineage for d2a6ma1 (2a6m A:4-133)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer

5. Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
   Pfam PF01797

6. Protein ISHP608 transposase [143426] (1 species)

7. Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
   Uniprot Q933Z0 4-133

8. Domain d2a6ma1: 2a6m A:4-133 [126287]
   protein/DNA complex; protein/RNA complex

Details for d2a6ma1

PDB Entry: 2a6m, 2.4 Å

PDB Description: Crystal Structure of the ISHp608 Transposase

PDB Compounds: (A:) ISHp608 transposase

SCOPe Domain Sequences for d2a6ma1:

Sequence; same for both SEQRES and ATOM records:

>d2a6ma1 d.58.57.1 (A:4-133) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
vkqyienqqn

Timeline for d2a6ma1:

• d2a6ma1 first appeared in SCOP 1.73
  
• d2a6ma1 appears in SCOP 1.75
  
• d2a6ma1 appears in SCOPe 2.02
  
• d2a6ma1 appears in the current release, SCOPe 2.08