Lineage for d2a6la1 (2a6l A:1-292)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834536Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2834575Species Escherichia coli [TaxId:562] [51575] (17 PDB entries)
  8. 2834604Domain d2a6la1: 2a6l A:1-292 [126285]
    complexed with k; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d2a6la1

PDB Entry: 2a6l (more details), 2.05 Å

PDB Description: dihydrodipicolinate synthase (e. coli)- mutant r138h
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d2a6la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6la1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpshtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d2a6la1:

Click to download the PDB-style file with coordinates for d2a6la1.
(The format of our PDB-style files is described here.)

Timeline for d2a6la1: