Class a: All alpha proteins [46456] (285 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein Sigma70 [88948] (2 species) |
Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries) Uniprot Q9WX78 |
Domain d2a6hp3: 2a6h P:74-257 [126279] Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp1, d2a6hp2 automated match to d1smyf3 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 2a6h (more details), 2.4 Å
SCOPe Domain Sequences for d2a6hp3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6hp3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]} kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad qart
Timeline for d2a6hp3: