Lineage for d2a6hp3 (2a6h P:74-257)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650700Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 650701Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 650702Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 650718Protein Sigma70 [88948] (2 species)
  7. 650721Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries)
  8. 650725Domain d2a6hp3: 2a6h P:74-257 [126279]
    Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc1, d2a6hd1, d2a6he1, d2a6hf1, d2a6hf2, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm1, d2a6hn1, d2a6ho1, d2a6hp1, d2a6hp2
    automatically matched to d1iw7f3
    complexed with mg, std, zn

Details for d2a6hp3

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOP Domain Sequences for d2a6hp3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6hp3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOP Domain Coordinates for d2a6hp3:

Click to download the PDB-style file with coordinates for d2a6hp3.
(The format of our PDB-style files is described here.)

Timeline for d2a6hp3: