Lineage for d2a6hp3 (2a6h P:74-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735969Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2735970Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2735971Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2735987Protein Sigma70 [88948] (2 species)
  7. 2735992Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries)
    Uniprot Q9WX78
  8. 2735996Domain d2a6hp3: 2a6h P:74-257 [126279]
    Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp1, d2a6hp2
    automated match to d1smyf3
    protein/RNA complex; complexed with mg, std, zn
    has additional subdomain(s) that are not in the common domain

Details for d2a6hp3

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a6hp3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6hp3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d2a6hp3:

Click to download the PDB-style file with coordinates for d2a6hp3.
(The format of our PDB-style files is described here.)

Timeline for d2a6hp3: